Camera accessories
Nikon F2 System Accessories Booklet Product booklet
Product booklet for Nikon F2 System Accessories Booklet. 27 pages in English. Read the original PDF, download or print a copy without registration.
27 pagesEnglish8.3 MB PDF
Loading your manual…Open PDF directly
Document details
- Brand
- Nikon
- Model / document
- Nikon F2 System Accessories Booklet
- Document type
- Product booklet
- Language
- English
- Pages
- 27
- File size
- 8.3 MB
- Category
- Camera accessories
- Document date
- Not specified in catalog
Search available document text
Find a term, then jump to its page in the original PDF. Image-only pages may not be searchable; check the PDF for exact wording and diagrams.
Page 2 · Read text
NA ikonMilestoneF2 inthe Advarrce of 35mm Photography Born to a unique heritage of infinite quality and versatility, the Nikon F2 is more than a magnificent camera. It is designed to expand the highest accomplishments of yesterday by using the most advanced technology of today to meet the photographic challenges of tomorrow. An unprecedented array of innovating features endows the Nikon F2 with capabilities never before available to the 35mm user, extending even into the realm of unmanned automatic photography. But, above all, the Nikon F2 is the supreme instrument for pictorially creative expression. Through "human engineering", in countless details, from the very contours of the camera body to the shape and placement of every control, the Nikon F2 transforms the picture-taking process into a swift, effortless flow of natural motions and becomes virtually an extension of the photographer's mind. Moreover, the Nikon F2 is designed to be part of the Nikon System, the most comprehensive in 35mm history. It accepts all the more than forty world-famous Nikkor lenses to give you a freedom of choice and an assurance of picture quality no other system can offer. With this matchless array of optics along with hundreds of Nikon accessories at your disposal, the Nikon F2 removes all limits to your photographic ambitions. And, you can depend on the proven Nikon System adaptability to technological advances to maintain the Nikon F2 as the world's foremost 35mm slr in the vears to come.View original page 2
Page 4 · Read text
TheNikonSystem
A Unique apploach to 35mm photography
Viewfinders-,.8 Itandis callone itthinga system.to buildIt isa camera,quite anotheradd a tofewconceivelenses andof theaccessories,camera
as a totally flexible instrument capable of taking an almost
infinite variety of forms, each uniquely suited for translating
specific pictorial ideas into effective photographs. That is the
concept on which the Nikon System is based.
Through years of constant, purposeful evolution, Nikon
designers have developed a system of interchangeable cameras,
lenses, viewfinders, finder screens, motor drives, close-up
attachments, and countless other accessories-a system that
stands unequalled in the world of photography. And, every
part of this system is calculated to contribute to the superlative
picture quality that is the Nikon photographer's ultimate reward.
Even more remarkable, however, is the Nikon System's immunity
to obsolescence. It is as though its designers foresaw future
technological advances and provided for their adoption into the
Nikon F can be easily transformed into a thoroughly up-to-dateMotor Drive System system by means of ingenious accessories. Thus, the very first slr with through-the-lens exposure control even though it -*16 predates that development by several years.
With this incomparable system to support his quest for pictorial
expression, there are no limits to the Nikon photographer's
horizon. And as the system continues to grow, year after year,
so do the rewards and the creative satisfaction of the million
photographers who have already made it their own.Reference List of
Nikon Accessories -,.rbView original page 4Page 5 · Read text
www.butkus.us Designed with an eye to the future, the Nikon F2 incorporates a number of innovative features. The camera offers a wide range of shutter speeds-maximum shutter speed of U2000 second, stepless speed selection between 1/80 and U2000 second and extra-slow shutter speeds of 2 to 10 seconds. It synchronizes with electronic flash at speeds up to 1/80 second. Accurate shutter speed and X synchronization are ensured by the faster shutter curtain travel time (less than 1,0 milliseconds) and the newly-devised shutter braking system. The curtain is made from super-strong and specially "quilted" titanium foil. The film advance lever is operated in a single sweep of 120" or in a series of shorter strokes. It also serves as an on/off switch for the exposure meter built into the Photomic finders. The F2 Photomic Finder DP-1 and F2S Photomic Finder DP-2 incorporate an accurate center-weighted through-the-lens exposure meter. Moreover, the F2 Photomic finden and Eye-Level Finder DE-1 feature a built-in ready-light for use with the Nikon electronic flash unit. Of special importance to professional users is the F2 motor drive system which is fully interchangeable among all Nikon F2 cameras. Other features of the Nikon F2 include a hinged back which may be removed to accept the 250 magazine back, a large automatic instant return mirror that eliminates image cut-off even with long telephoto lenses, and neck-strap eyelets fortified with a stainless steel inset to prevent wear. In addition to some 40 new accessories designed exclusively for it, the Nikon F2 accepts almost all of the accessories created for its predecessor, the Nikon F.View original page 5
Page 6 · Read text
Venmo @mike-butkus-camera Ph. 2083 PayPal Name Lynn@butkus.org www.PayPal.me/lynnbutkusView original page 6
Page 9 · Read text
Shutter Speed Selector Shutter Speed Index Mark Shutter Speed DialSpeeds froftr I to ll2OOO sec. plus B. ReadvJieht Indicales irrhen Nikon electronic flash unit is ready to fire. Finder Eveoiece Accepts vdridus screw-in accessories. Film TYansport Sprockets Take-up Spool Multi-slSttetl for easier film loading. Titanium-foil Shutter Curtain Readv-light ContactConnetts'urith the Nikon electronic flash unit by means of the ready-ligbt adapter. Finder Release Button Depress to release the finder and focusing screen. Memo HolderHolds the end flap of film box as reminder of film type. speed and number of exposures. Camera Back Hinged to swiqg open. Can be removed to fit a camera andmotor with a 25o-exposure magazine back.View original page 9
Page 11 · Read text
principle which avoids the disadvantages of other systems using
averaging or spot meters.
The former cannot distinguish among various parts of the
picture area and thus may be induced by an unusually hright
or dark background to give a wrong reading for the main
subject. So-called spot meters, on the other hand, demand
considerable expertise in selecting the area to be measured and,
in most situations, require several readings from which the
actual exposure must be calculated. And systems combining
both types not only inherit the drawbacks of both but add the
further problem of constantly having to decide which to use.
While the Photomic meter observes the brightness of the entire
picture area,6O7o of its sensitivity is concentrated on the
central L2mm-diameter circle outlined on the finder screen-
approximately 1/8 of the total area. The meter sensitivity
diminishes sharply from this area towards the edges of the
screen.
As a result, the Photomic system provides accurate exposure
with a single reading, not only for general situations but also
where there is a marked difference in brightness between
central subject and surrounding area. It is equally accurate
whether the camera is used in horizontal or vertical position.
The exclusive feature of the Nikon F, the most accurate 35mm What's more, the system works with all Auto Nikkor lenses at
finder system, has been retained in the Nikon F2. It shows full aperture so that the finder remains at maximum brightness
the area recorded on the film, permitting precise composition even while you set your exposure. It also permits stop-down
right up to the edges of the frame. This unique viewing readings, with non-automatic lenses and when bellows or
accuracy is implemented by a special group of interchangeable extension tubes are used. Complete exposure information is
F2 finders. The camera is supplied with a choice of standard visible in the viewfinder.
Eye-Level Finder DE-1 or F2 Photomic Meter/Finder DP-1. The eyepiece of the F2 Photomic, F2S Photomic and Standard
Four others-F2S Photomic Meter DP-2, Waist-Level Finder Prism Finders contains a ready-light which, when connected to
DW-1, 6X Focusing Finder DW-2, and Action Finder DA-l* the Nikon Electronic Flash Unit, lets you check flash readiness
are available as accessories, as are the first two named. without taking your eye off the finder. The F2S Photomic
The Photomic finders embody a through-the-lens metering accepts the EE Aperture Control Attachment which equips the
system based on the Nikon-developed "center-weighted" Nikon F2 with self-activating, fully automatic exposure controlView original page 11Page 12 · Read text
www.butkus.us
F2 Photomic Finder DP-1 withThe F2thePhotomicthrough-theJenscombines"center-weighted"a bdlliant eyelevelmeterprismsystemfinderfor
quick, aceurate and reliable exposure control, even in difficult
lighting situations. It is powered by two silver oxide batteries
housed in the camera baseplate and coupled to both lens
aperture and shutter speed controls. Complete exposure data
is visible beneath the picture area: meter needle, indicating
correct, over or under.exposure, plus selected aperture and
shutter speed settings. The meter needle also appears in a
window on top of the Photomie housing. Using the meter
involves no added operation-the on/off switch is activated
by the film transport lever.
The F2 Photomic offers an uncommonly wide metering range,
from EV 1 to EV 17 (e.g., 1 second atf ll.4to 1/2000 at f/8
with ASA 100 film, using the 50mm f/1.4 lens). It can be set
for film ratings from ASA 6 to 6400 and couples to Auto-Nikkor
lens apertures from f/1.2 to f/32, as well as all shutter speeds.
A special feature of the F2 Photomic is the eyepiece readylight
for use with the Nikon Electronic Flash Unit. The eyepiece
accepts various accessories (eyepiece correction lenses, right angle
finder, eyepiece magnifier, rubber eyecup and Photomic
illuminator).View original page 12Page 13 · Read text
Nikon \! Nikon tt Eye-LevelFinder DE-1 \lilaist-Level Finder DW-l Designed for use in general photography, the Standard prism This finder is especially useful for macro photography and Finde: DE"1. has an extra-large eyepiece for comfortable focusing copying. It also permits viewing and focusing with the and composing. The finder accepts valious accessories such as camera held overhead or at a low position. The hood opens the eyepiece magnifier, elepiece correction lenses, etc. The DE-1 at the touch of a button and folds compactly against the also incorporates a ready.light for use with the Nikon electronic camera body. A fold-away 5X magnifier isbuilt-in toflash unit. facilitate eritical foeusing.View original page 13
Page 14 · Read text
www.butkus.us
F2S Photomic Finder DP-2 al,lC Battery DN-1
Power for the EE Aperture Control Attachment is furnished
by the NC Battery DN-1 which is housed inside the attachment
and can be recharged using the NC Battery Charger DH'1.
The F2S Photomic may be used by itself as a prismfinder/meter or with the EE Aperture Control Attachment .as
for fully automatic, s€lf-activating exposure setting.
Similar in principle to the F2 Photomic, the F2S provides
through-the-lens "center-weighted" metering at full
aperture. Its sensitivity, however, is truly astonishing'
ranging from EV minus 2 to EV 1?. This means accurate
readings in light so dim that it would require an exposure aEE Aperture Cont.ol Attac*tment DS-1
of 8 seconds at f/1.4 with ASA 100 film-without any
booster attachment! Used in conjunction with the F2S Photomic, this ingenious
Instead of a meter needle, the F2S Photomic uses solid- attachment transforms the Nikon F2 into a fully automatic
state light-emitting diodes as exposure indicators. camera. It embodies a tiny servo motor which is activated
Plus or minus symbols glow to signal over. or under" by the exposure meter and automatically adjusts the lens
exposure, and both glow simultaneously to indicate aperture ring for the correct f-stop. The EE Aperture
correct exposure. Lens aperture and shutter speed settings Control Attachment slips easily onto the front of the camera
are also visible in the finder as is the eyepiece ready-light and automatically makes contact with the F2S Photomic
for use with the Nikon electronic flash. The F2S Photomic without any cords. It uses a self-contained, rechargeable
adjusts for films from ASA 12 to 6400 and couples to NC battery and works with all Auto-Nikkor lenses without
Auto Nikkor lens apertures f ll,2 to f 132, as well as all any modifieations. The AC/DC Converter MA-4 with the
shutter speed settings. It accepts the same eyepiece attach- DM-1 connecting cord is also available for the supply of DC
ments as the F2 Photomic and Standard Prism Finders. power to the attachment from a house current.
12View original page 14Page 16 · Read text
www.butkus.us
N ikon
Action Finder DA-1 6X Focusing Finder t)W-2
The extra-large prism and rectangular eyepiece of the Designed initially for parallax focusing with cross'hair
action finder permit full frame viewing even with the eye focusing screens, it magnifies the entire viewing field
as much as 60mm (2-1/2 inches) away from the eyepiece. by 6 times. But the 6X focusing finder can also be used
It is ideal for fast moving action or for use by those who with split-image or microprism screens for close-ups and
need to wear glasses or goggles, or in specialized scientific macrophotoEaphy, astrophotography and other
applications where the eye cannot be brought close to the applications requiring extremely fine focusing. Its
finder eyepiece. optical construction, similar to a fine lens, produces an
exceptionally bright viewing image. The eyepiece may be
adjusted from -b to +3 diopters.View original page 16Page 18 · Read text
www.butkus.us
I Greg wagner
.@
Motorized Nikon F2 camera with 250
Magazine Back MF-1 and SC Remote
Control Cord.View original page 18Page 19 · Read text
Backed by years of experience in building motor-driven
35mm cameras, Nikon has designed for the Nikon F2
camera a system of motorized photography that combines
the rugged strength and reliable performance of earlier
Nikon motor drive equipment with the latest technological
advancements in this field.
The core of the new system is the basic Motor Drive
MD-2, capable of shooting 36 frames at variable speeds up
to five frames per second, besides carrying out single-frame
operations. It is quickly attached to the baseplate of any
F2 or F2 Photomic camera without having to remove the
camera back, and is powered by the standard Cordless
Battery Pack MB-1 or an external power source. For
firing 250 frames continuously without reloading, the 250
Magazine Back MF-1 is used in combination with the MD-2.
The magazine backs are readily fastened to the camera body
in place of the detached camera back. Other features of
the MD-2 include motorized film rewinding and a built-in
relay for remote control photography by wire or radio.
For motorized film rewinding, the optional camera back
MF-3 permits automatic film rewind stop to leave the film
leader out of the cassette.
One obvious use of the motor drive is sequence photography,
such as sports photos, time lapse studies, security surveillance,
or where the camera is operated from a distance. In these
17View original page 19Page 20 · Read text
www.butkus.us areas, the motorized Nikon F2 with its higher shutter
speeds, ldrger format and superior film flatness produces
far better picture quality than movie cameras.
Then, again, many professionals regard the motor drive as
an integial part of their Nikon which endows the camera
with truly instant and continuous responsiveness' They
rely on iti automatic fire power to capture the vital
moment, the fleeting expression that makes a picture
tell a story-and that is so often lost because it occun
just afterin exposure has been made and before the
photographer advances his camera for the next shot'
Motor Drive MD-2
The Motor Drive MD-2 offers a choice of five different
firins speeds-H, M3, M2, M1 and L-and is capable of
shooiing up to 36 frames at the maximum speed of five
Motor Drive MD-2 frames per second. The standard alkaline or manganese
batteriei will provide speeds of 1-4 fps while the nickel
cadmium battiries or the AC/DC Converter MA-2 or
MA-4 will provide power for the shooting up to 5 fps'
Firing speeds are set by turning the selector knob at the
back of the motor drive.
The Motor Drive MD-2 has a built'in relay for remote
control. The grip head may be removed from the motor
drive unit for remote control triggering at distances up to
three meters (ten feet). The 4-pin plug at one end of the
SC Remote Cord MC-1 is connected to where the grip
head is normally attached, and the grip head' containing
the SC (single-continuous) knob and trigger button' is
fitted to the other end of the cord. Remote triggering
is also possible at greater distances using the Nikon
Cordless Battery Pack MB wireless remote control.View original page 20Page 21 · Read text
With the MD.2, motorized rewinding of the standard
film of 36 exposures takes about 7 seconds.
The LED (light emitting diode) indicator lights up
when the film is being wound.
Another outstanding feature of this motor drive is its
complete interchangeability.
Without removing the camera back and without any
modifications, it may be attached to any F2 camera,
simply by removing the O/C key in the baseplate and
screwing the motor drive unit into position.
Gordless Battery Fack MB-l
It houses either the NC Battery Unit MN-1 (consisting
of two NC batteries) or the AA Penlight Battery Unit
MS-1 (containing ten 1.5V penlight batteries) to power
the Motor Drive MD-2.
The battery pack is attached directly to the base of
the motor drive, without any external connecting cord.
Camera Back MF-3
\{hen used with the Camera Back MF-3, the motor for
rewinding stops automatically when the film end is
disengaged from the take-up spool (the film leader remains 250 Magazine Back MF-l
out of the film cassette). This feature is convenient for
automatic processing, handling in the darkroom, etc. The
camera back can be used on any Nikon F2 body, to
ptovide a b€tter grip. The LED indicator of the MD-2
lights up when film rewinding is completed.
25O Magazine Back MF-1
This accessory magazine back permits bulk film loading
and exposures of up to 250 frames. Mounted in place of NC Battery Unit MN-lthe standard hinged and removable camera back, the MF-1is powered by the Motor Drive MD-2. -- NC Battery Charger MH-lView original page 21Page 22 · Read text
www.butkus.us
250 Exoosure Film Cassette
Bulk Film Loader
AC/DC Converter MA-2View original page 22Page 23 · Read text
NC Batteries MN-l Bulk Film Loader
Two 7.5 Volt NC batteries MN-1 can be inserted into For rapid loading of up to 10m (33 ft.) of film into the
the Cordless Battery Pack MB-1 to provide the motor 2S0exposure film cassette from a bulk film roll. Stops
drive with firing speeds of up to 5 frames per second. automatically at preset film length. Has fluorescent frame
number markings visible in the dark.
NC Battery Charger MH-lThe MH-1 provides a quick recharge for the NC 25O Exposure Film Cassette
batteries MN-1. With a 3-hour charge the batteries A pair of reloadable film cassettes-one for film supply
achieve 80% of charge-the balance in the next 3 hours. and the other for take-up-is used in combination with the
250 Magazine Back MF-1. It holds up to 10m (33 ft.) of
AA Penlight Battery film for a maximum of 250 exposures.
Holder MS-1 Repeating Electronic Flash Unit
Holding ten 1.5 Volt AA penlight batteries, either alkaline The unit consists of a flash head and an AC or a DC power
or manganese, the MS-l supplies power to the motor pack, and is used in combination with the motor drive
drive for firing up to 4 frames per second. Extra battery mounted on the Nikon F2 for sequence photography, mo-
compartments, already loaded with fresh batteries, may tion analysis, etc. It performs synchronized repeating
be carried for fast battery changes. flashes at the rate of 3 frames per second. Its short flash
duration-1/20,000 second at 1/3 peak-permits freezing
AC/DC Converter MA-2 of fast moving subjects. The color temperature is 6,000"K.
The converter, when connected to AC power source, supplies
stabilized 15 Volt DC power to the Motor Drive MD-2,
using the MC-2 connecting cord.
AC/DC Converter MA-4
Supplies DC power to both the Motor Drive MD-2 (with the
MC-2 connecting cord) and the EE Aperture Control
Attachment DS-1 (with the DM-1 connecting cord).View original page 23Page 25 · Read text
The Nikon F2 user has a choice of 19 focusing screens The chart below listS the screens which can be used with (13 basic types) - with Type A supplied as standard each lens. Some screens in the "Acceptable" column mayequipment and the other 18 available as optional show slight vignetting or moire (but image on film is accessories. Each screen offers special advantages in not cut off). specific photographic applications.View original page 25
Page 27 · Read text
tvpeF o: tvpeT- lt G
"i
I
l_
Fine matte field with a cross Overall, fine matte field Matte/Fresnel field with a Clear Fresncl ficld with ahair reticle in a clear 4mm- ensures unobstructed view- 12mm-diameter circle and 1 2mm-diameter microprisntdiameter center spot. For ing. Used especially with etched vertical and horizon- tocusing spot. Providoi an
photomicrography and long telepholo lenses or for tal reference lines. For extremely brilliant imagc
astrophotography, and other close-up work, picture taking that requires Iot locusinr in low light.
applications involving high accurate image placement or Available in + modeli t o
magnifications, for parallax alignment such as architec- match various focal
or aerial-image focusing. tural photography with length lcnses.
Requires viewfinder with PC-Nikkor, and cbpying
focusing control. (6X finder work.
or 2X magnilier, both with
variable diopter eyepiece)
e
I
Similar to Tvpe A screen. Wilh a double cross-hair Matte/Fresnel I'ield with a Matte/Fresnel f ield with abut with the iplit-image reticlc and scales on a clear cenlral 3mm'diameler splil- central 3mm-diameter circu-rangefinder liie at a 4-5' surface. Recommended for image rangefinder divided at lar split'image rangefinder
angle. Especially effective photomicrography, close- a 45" angle. A 1mm-wide and etched horizontal and
when focusing on an object ups and other work involving microprism band and a vertical lines. No image
with horizontal lines. high magnificalion. Requires 1 2mm-diameter reference darkening in the rangefinder
viewfinder with focusing circle surround the range- even with the lenses having
control. (6X finder or 2X finder. Has etched horiTon- maximum apertures betweet
magnifier with variable tal and vertical lines t<r l'l3.5 and f/5.6.
diopter eyepiece) facilitate composition. Icleal lor architectural and
Suitable for general commercial photography. photographl,'.
25View original page 27From the M. Butkus archive. Original publisher and archive notices are retained.
Check the model and edition against your equipment.
PDF verified 2026-10-10.